PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010921550.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Arecoideae; Cocoseae; Elaeidinae; Elaeis
Family NAC
Protein Properties Length: 314aa    MW: 35509.1 Da    PI: 8.2888
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010921550.1genomeOGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM177.24.4e-5551311128
             NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.kkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevls 94 
                     lppGfrFhPtdeel+ +yL +kv++ ++ + ++i+evd++k+ePw+Lp k+++ +ekewyfFs rd+ky+tg r+nrat++gyWk+tgkdke+++
  XP_010921550.1   5 LPPGFRFHPTDEELIICYLSRKVSDFRFVT-KAISEVDLNKCEPWELPgKTINMGEKEWYFFSLRDRKYPTGLRTNRATDAGYWKTTGKDKEIFH 98 
                     79*************************998.88***************889999***************************************** PP

             NAM  95 kkgelvglkktLvfykgrapkgektdWvmheyrl 128
                      +g  vg+kktLvfykgrap+gekt Wvmheyrl
  XP_010921550.1  99 -SGVPVGMKKTLVFYKGRAPNGEKTGWVMHEYRL 131
                     .999****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019413.79E-633152IPR003441NAC domain
PROSITE profilePS5100558.6485152IPR003441NAC domain
PfamPF023657.5E-286131IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 314 aa     Download sequence    Send to blast
MEVNLPPGFR FHPTDEELII CYLSRKVSDF RFVTKAISEV DLNKCEPWEL PGKTINMGEK  60
EWYFFSLRDR KYPTGLRTNR ATDAGYWKTT GKDKEIFHSG VPVGMKKTLV FYKGRAPNGE  120
KTGWVMHEYR LHAKFPYKST KEEWVVCRVF RRSSNGKKLQ EGTSSMPNLL GSSCNTTSTT  180
ELGEPNTSML GKLINSSSTL DAVLINKDDD NNSTDKMDMN FAKEPTNEIM QYDEWPSGLL  240
SSSFSTNPTI LKALQLDNKQ PREATDMATL NPFVAQGDAI YGVESSSSFP ASSSRGSDSM  300
QRRLFDQKSI WTGF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swm_A9e-56215817174NAC domain-containing protein 19
3swm_B9e-56215817174NAC domain-containing protein 19
3swm_C9e-56215817174NAC domain-containing protein 19
3swm_D9e-56215817174NAC domain-containing protein 19
3swp_A9e-56215817174NAC domain-containing protein 19
3swp_B9e-56215817174NAC domain-containing protein 19
3swp_C9e-56215817174NAC domain-containing protein 19
3swp_D9e-56215817174NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010921550.10.0PREDICTED: NAC domain-containing protein 100-like
SwissprotQ9FLJ27e-77NC100_ARATH; NAC domain-containing protein 100
TrEMBLB9IE381e-114B9IE38_POPTR; Uncharacterized protein
STRINGPOPTR_0015s03700.11e-113(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP79193450
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18400.11e-93NAC domain containing protein 58